|
DIK2TSPHSLDC - Don't Invite Kevin 2 The Sex Party, He Smells Like Dragon Con
|
#
?
Dec 10, 2014 20:32
|
|
|
|
| # ? May 4, 2024 05:03 |
|
|
SPWARH,IYH: The sex party was always right here, in your heart
|
|
#
?
Dec 10, 2014 20:33
|
|
|
NS4BM - Now Schilling For Big Monsanto
|
|
#
?
Dec 10, 2014 20:33
|
|
|
PSAMLPDIGASIUYBTMADAMOTDJAYROWSCOWIAFS - Please soak a my little pony doll in gasoline and shove it up your butt then masturbate and drop a match on the doll just as you reach orgasm while smoking crack on wecam in a fur suit. Kids these days. *shakes head*
|
|
#
?
Dec 10, 2014 20:34
|
|
|
RTPW - Remove thine pantaloons, wench ARIMUD - A rattlesnake is in my underwear drawer IA@BM - I am at Bat Mitzvah HSIHHL - Holy poo poo I have head lice IWKASH - I wasn't kidding about the snake, help
|
|
#
?
Dec 10, 2014 20:34
|
|
|
CIA = Central Intelligence Agency In rear end
|
|
#
?
Dec 10, 2014 20:34
|
|
|
JM2DISW = Just masturbated to the dad in Small Wonder
|
|
#
?
Dec 10, 2014 20:35
|
|
|
TIWAABIW3KIT - Thought It Was An Adult, But It Was 3 Kids In a Trenchcoat
|
|
#
?
Dec 10, 2014 20:35
|
|
|
NUKWICFSK = Nigga you know where I can find some Kale?
|
|
#
?
Dec 10, 2014 20:37
|
|
|
LAL2D- lost another loan to ditech
|
|
#
?
Dec 10, 2014 20:38
|
|
|
HABB - Help Attacked By Bear PD;DC = Parents Dead; Don't Care
|
|
#
?
Dec 10, 2014 20:38
|
|
|
KC4MN = Kale Chips For My Niggas
|
|
#
?
Dec 10, 2014 20:38
|
|
|
SFMHR, C = Suck And gently caress My Hot Rod, Carol
|
|
#
?
Dec 10, 2014 20:39
|
|
|
CPUTR - Currently Puttin' On The Ritz
|
|
#
?
Dec 10, 2014 20:40
|
|
|
BAIFWCPR : Burning Alive In Flaming Wrecked Car, Please Retweet
|
|
#
?
Dec 10, 2014 20:41
|
|
|
ETIBP-Extra time in ball pit
|
|
#
?
Dec 10, 2014 20:41
|
|
|
NMCOAS : Need More Copies Of Atlas Shrugged
|
|
#
?
Dec 10, 2014 20:42
|
|
|
 These kids and their acronyms, it's all about word usage now, like 'epic', 'lelz', 'cuck'.
|
|
#
?
Dec 10, 2014 20:44
|
|
|
Lowtax posted:
|
|
#
?
Dec 10, 2014 20:44
|
|
|
GOBC - Get On BogChat
|
|
#
?
Dec 10, 2014 20:45
|
|
|
IAPOYNIAMBCOYBSDDACAWIDWTIGCOYP - I am peeing on you now. I am making big circles on your big stupid dead druidface and chest, and when I'm done with that, I'm gonna crap on your paladin.
|
|
#
?
Dec 10, 2014 20:48
|
|
|
FLMBF frog on a log in the middle of the bog fetish
|
|
#
?
Dec 10, 2014 20:49
|
|
|
BPTN - Bog Party Tomorro Night BYOB -Brng Your Own Bog TCBY - Totally Cool Bog Youth
|
|
#
?
Dec 10, 2014 20:51
|
|
|
BJHALF - Benjamin Jones has a limp frog
|
|
#
?
Dec 10, 2014 20:51
|
|
|
DRUGS - Schoolwork
|
|
#
?
Dec 10, 2014 20:52
|
|
|
JTAHD : Just Touched A Haunted Dick
|
|
#
?
Dec 10, 2014 20:53
|
|
|
PMNA - Poz My Neg rear end
|
|
#
?
Dec 10, 2014 20:54
|
|
|
PTBP - Pass the bog paper
|
|
#
?
Dec 10, 2014 20:54
|
|
|
Hand Beezy - Weed
|
|
#
?
Dec 10, 2014 20:54
|
|
|
TANE - Tits an' ears
|
|
#
?
Dec 10, 2014 20:55
|
|
|
S4SREM : Shot-for-Shot Remake of an Ernest Movie
|
|
#
?
Dec 10, 2014 20:56
|
|
|
WXFFTTTTW- watchin x-files for the third time this week
|
|
#
?
Dec 10, 2014 20:56
|
|
|
FTGTNIDCM - gently caress this Gary thread no I didn't censor myself
|
|
#
?
Dec 10, 2014 20:58
|
|
|
SAWW - Shrimp and white wine
|
|
#
?
Dec 10, 2014 20:59
|
|
|
BDIR - Blue dad in room
|
|
#
?
Dec 10, 2014 21:00
|
|
|
CFRMIBOSYSP - Can't find Randy Moss in this bog oh poo poo you said peat
|
|
#
?
Dec 10, 2014 21:01
|
|
|
jiharlequinade posted:BGO - Bog
|
|
#
?
Dec 10, 2014 21:01
|
|
|
F12YHVAWIJGTIJGSIATMWLHLIATMWNSHLOHVIAMTMWHDYOV&THDYWAIYWTKWYAPYWDKITMWWNWTYTCEWTOOATMHRTATSASFWIDBTSRETSHNC2BSOHVFTAOTCOTWTTCESAIHWSHITRNTOGBTOMIWNTTOAMBTTOAAM = For twelve years, you have been asking: Who is John Galt? This is John Galt speaking. I am the man who loves his life. I am the man who does not sacrifice his love or his values. I am the man who has deprived you of victims and thus has destroyed your world, and if you wish to know why you are perishing-you who dread knowledge-I am the man who will now tell you." The chief engineer was the only one able to move; he ran to a television set and struggled frantically with its dials. But the screen remained empty; the speaker had not chosen to be seen. Only his voice filled the airways of the country-of the world, thought the chief engineer-sounding as if he were speaking here, in this room, not to a group, but to one man; it was not the tone of addressing a meeting, but the tone of addressing a mind.
|
|
#
?
Dec 10, 2014 21:02
|
|
|
Let's meet at the same time Same place Send your jpeg, I wanna see your face Girlfriend, send an I.M. TTYL No time to spell Oops, there goes that little bell Bye, bye for now BBFN Hey, LOL, G2G I gotta go, but watch for me 'cause I'll be right back, BRB So sign on, and I.M. me Mom thinks I'm doing homework Yeah, research But I can't help it, I've just got to surf I gotta chat with my girlfriends on line We're digital divas Believe us This Girl Wide Web is hot stuff My buddy list is growing all the time Hey, LOL, G2G I gotta go, but watch for me 'cause I'll be right back, BRB So sign on, and I.M. me I got a web page A domain Sign my guest book with your screen name Check it out, then send an I.M. What's your profile? Favorite quote? This is just like passing notes It's easier to type than use a pen Hey, LOL, G2G I gotta go, but watch for me 'cause I'll be right back, BRB So sign on, and I.M. me Hey, LOL, G2G I gotta go, but watch for me 'cause I'll be right back, BRB So sign on, and I.M. me Hey, LOL, G2G I gotta go, but watch for me 'cause I'll be right back, BRB So sign on, and I.M. me
|
|
#
?
Dec 10, 2014 21:02
|
|
|
|
| # ? May 4, 2024 05:03 |
|
|
bog = vagina Common usage: "I want to bury myself in your bog like I was an ancient celtic sacrificial victim".
|
|
#
?
Dec 10, 2014 21:02
|
|